PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G2222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 259aa    MW: 31495.7 Da    PI: 8.7011
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G2222genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.91.6e-2435118186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  +W+ qe+++ + +r e++ ++ ++k++k+lWe +s +++e+g++rs++qCk+kw+nl +ryk ++  e++   ++++++p++++l+
  Gh_D01G2222  35 QWSIQETKEFLMIRAELDPSFMETKRNKQLWEFISTRLKEKGYNRSAEQCKCKWKNLVTRYKGCEMVEEEA--KRQQQFPFYNDLQ 118
                  7********************************************************************95..66678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122032.04E-213499No hitNo description
PfamPF138371.3E-1935120No hitNo description
PROSITE profilePS500907.5153692IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MEGLHHHQYY HRQHHQQQHQ QQAMNVNVDV DRLPQWSIQE TKEFLMIRAE LDPSFMETKR  60
NKQLWEFIST RLKEKGYNRS AEQCKCKWKN LVTRYKGCEM VEEEAKRQQQ FPFYNDLQAI  120
FSARKQTTSK KLCSDEEEDK GRYRGKEKGK KGVSISGSPS ESINDGNDIK EILKCFMRQQ  180
LELEIQWREA LEVRENERRL KEMEWRRTME ALENERVMMD IRWREKEEQR RIREEARSER  240
IDALVTTLLN KLTRDDHMK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468500.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotO804508e-55TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0D2RCJ60.0A0A0D2RCJ6_G
STRINGPOPTR_0006s10240.11e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22152870
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.12e-50Trihelix family protein